PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015883135.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family NF-YB
Protein Properties Length: 155aa    MW: 17444.7 Da    PI: 4.3137
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015883135.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB75.86.4e-241194386
           NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                    ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +++se+++ c re+++ti+++ +l al  lGf +y+e++ + 
  XP_015883135.1 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCSREEKRTIAPEHVLKALEVLGFGEYIEEVYAA 94
                    6899***************************************************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.5E-408140IPR009072Histone-fold
SuperFamilySSF471137.42E-3612140IPR009072Histone-fold
PfamPF008081.3E-211479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MEPMDIVGKS KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLISSESNE  60
VCSREEKRTI APEHVLKALE VLGFGEYIEE VYAAYEQHKL ETMQDLKSGK WSNGAEMTEE  120
EALAEQQRMF AEARARMNGG TNPPKQPDPD QNLDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B5e-361213412133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015883135.11e-113PREDICTED: protein Dr1 homolog isoform X1
SwissprotP495921e-91NC2B_ARATH; Protein Dr1 homolog
TrEMBLW9SUR91e-104W9SUR9_9R
STRINGGLYMA05G07750.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47663358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.27e-93nuclear factor Y, subunit B13